PDKtide Cell Signaling Reagents Peptide Substrates


Home › Cell Signaling Reagents - Peptide Substrates › PDKtide

PDKtide (P10-58)
Catalog Number Pack Size Price (USD)  
PDKtide P10-58 1 mg $95   PDKtide Add to Cart
PDKtide P10-58-BULK BULK CONTACT US  
* Prices listed in the "shopping cart" are not discount inclusive. Promotional Prices will be applied internally during the processing of orders and net totals adjusted accordingly.

Bulk Pricing for PDKtide

Product Data Sheet(s)




Description: The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Tag:
Expression System:
Species:
Sequence: KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
   
   

Purity: Determined to be 95% by HPLC analysis.

Formulation: 1mg of peptide supplied as a lyophilized powder.

Storage, Stability, and Shipping: Store product at –20oC. For optimal storage, aliquot diluted product into smaller quantities and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.

Applications: Kinase Assay

Molecular Weight: 4771.36





PDKtide Research Areas

The PDKtide product can be utilized in the following research areas, but not limited to:

AKT/PKB Pathway, Angiogenesis, Apoptosis/Autophagy, Cancer, Cardiovascular Disease, Inflammation, Invasion/Metastasis, Metabolic Disorder, Neurobiology, NfkB Pathway, WNT Signaling



PDKtide Related Products Found: Total 4 Related Products
Product Type Product Name Catalog Number Application Pack Sizes
Enzymes PDK1, Active P14-10H Kinase Assay, Western Blot View PDK1, Active
Enzymes CDK9/CyclinK, Active C40-10G Kinase Assay, Western Blot View CDK9/CyclinK, Active
Enzymes CDC7/DBF4, Active C26-10G Kinase Assay, Western Blot View CDC7/DBF4, Active
Signaling Proteins CDC7 Protein C26-30G Western Blot View CDC7 Protein


Items in Your Cart (0)
Product Types
Enzymes
Enzymes Active Acetyltransferases Active Acetyltransferases
Enzymes Active Arginine Deiminases Active Arginine Deiminases
Enzymes Active Histone Deacetylases Active Histone Deacetylases
Enzymes Active Kinases Active Kinases
Enzymes Active Methyltransferase Active Methyltransferase
Enzymes Active Phosphatases Active Phosphatases
Enzymes Active Phosphodiesterases Active Phosphodiesterases
Extracellular Ligands
Extracellular Ligands Chemokines Chemokines
Extracellular Ligands Cytokines Cytokines
Extracellular Ligands Growth Factors Growth Factors
Signaling Proteins
Signaling Proteins Acetyl/Methyltransferase Proteins Acetyl/Methyltransferase Proteins
Signaling Proteins Adaptor Proteins Adaptor Proteins
Signaling Proteins Apoptosis Proteins Apoptosis Proteins
Signaling Proteins Arginine Deiminases Arginine Deiminases
Signaling Proteins Cell Cycle Proteins Cell Cycle Proteins
Signaling Proteins Cell Stress & Chaperone Proteins Cell Stress & Chaperone Proteins
Signaling Proteins Cellular Proteins Cellular Proteins
Signaling Proteins Deacetylase/Demethylase Proteins Deacetylase/Demethylase Proteins
Signaling Proteins Fructose Kinase Proteins Fructose Kinase Proteins
Signaling Proteins G-Proteins G-Proteins
Signaling Proteins Lysyl Oxidase Proteins Lysyl Oxidase Proteins
Signaling Proteins Methylcytosine Dioxygenase Proteins Methylcytosine Dioxygenase Proteins
Signaling Proteins Microtubule/Actin Associated Proteins Microtubule/Actin Associated Proteins
Signaling Proteins Tau Proteins Tau Proteins
Signaling Proteins Transcription Proteins Transcription Proteins
Signaling Proteins Ubiquitin Proteins Ubiquitin Proteins
Signaling Proteins Unactive Kinases Unactive Kinases
Signaling Reagents
Signaling Reagents Assay Reagents Assay Reagents
Signaling Reagents Oligo Substrates Oligo Substrates
Signaling Reagents Peptide Substrates Peptide Substrates
Signaling Reagents Protein Substrates Protein Substrates
Antibodies
Antibodies Isoform Specific Antibodies Isoform Specific Antibodies
Antibodies Modification Antibodies Modification Antibodies
Antibodies Phospho Specific Antibodies Phospho Specific Antibodies
Antibodies Primary Antibodies Primary Antibodies
Antibodies Secondary Antibodies Secondary Antibodies
Antibodies Tag Antibodies Tag Antibodies
Discovery Services
Compound Selective Profiling Compound Selective Profiling
Custom Protein Development Custom Protein Development

Research Categories
AKT/PKB Pathway AKT/PKB Pathway
Angiogenesis Angiogenesis
Apoptosis/Autophagy Apoptosis/Autophagy
Cancer Cancer
Cardiovascular Disease Cardiovascular Disease
Cell Cycle Cell Cycle
Cellular Stress Cellular Stress
Cytoplasmic Tyrosine Kinases Cytoplasmic Tyrosine Kinases
ERK/MAPK Pathway ERK/MAPK Pathway
Inflammation Inflammation
Invasion/Metastasis Invasion/Metastasis
JAK/STAT Pathway JAK/STAT Pathway
JNK/SAPK Pathway JNK/SAPK Pathway
Lipid Kinases Lipid Kinases
Metabolic Disorder Metabolic Disorder
Neurobiology Neurobiology
NfkB Pathway NfkB Pathway
p38 Pathway p38 Pathway
Phosphatases Phosphatases
Phosphodiesterases Phosphodiesterases
PKA/PKC Pathway PKA/PKC Pathway
Receptor Tyrosine Kinases Receptor Tyrosine Kinases
Ser/Thr Kinases Ser/Thr Kinases
WNT Signaling WNT Signaling




Keep in touch, join us on:
PDKtide Cell Signaling Reagents Peptide Substrates    PDKtide Cell Signaling Reagents Peptide Substrates    PDKtide Cell Signaling Reagents Peptide Substrates