The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Catalog No. P10-58
Catalog No. | Pack Size | Price (USD) | |
---|---|---|---|
P10-58 | 1 mg | $105 | |
P10-58-BULK | BULK | Contact Us |
No overview information available.
Purity:
Determined to be 95% by HPLC analysis.
Storage, Stability and Shipping:
Store product at –20oC. For optimal storage, aliquot diluted product into smaller quantities and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.
Molecular Weight:
4771.36
AKT/PKB Pathway, Angiogenesis, Apoptosis/Autophagy, Cancer, Cardiovascular Disease, Inflammation, Invasion/Metastasis, Metabolic Disorder, Neurobiology, NfkB Pathway, Ser/Thr Kinases, WNT Signaling
STAY CONNECTED
Fax: 1-604-232-4601